Klaro cross-checks the world's press on each event and extracts the neutral, shared fact — no editorial line, no opinion.

Navigate

Home
About
How it works
Countries
Privacy
Terms
Contact

Topics

World
Politics
Business
Tech
Science
Health
Sports
Culture
Environment

© 2026 Klaro News

·

Neutrality as a visible method.

Blattlause Weiße Fliege Falscher · Klaro News

Blattlause Weiße Fliege Falscher

All the news on this topic, cross-referenced across the world's press — the neutral facts.

karoline leavitttrumpleavittdonald trump
+565 d ago
The 28-year-old, the youngest in the role, will focus on family but remain a top outside advisor to Trump
Reliability 85 · very high56 sources31 independent voices24 countries · 14 languages
blind spot · Centerrewrites detected

trumpestados unidosdonald trumpadvertisement world donald trump

11 d ago

Trump calls Michigan election corrupt

Reliability 79 · high9 sources·5 independent voices·7 countries · 4 languages

Framing differsrewrites detected

trumpirantreasury secretary scott bessentdie auseinandersetzung

+422 h ago

Trump’s team fires back at bombshell Iran claim by ex-MAGA congresswoman

Reliability 65 · high6 sources·1 independent voice·3 countries · 2 languages

blind spot · Right siderewrites detected

jordanieniransoldaten vergeltungsschlageregionalkommando centcom

30 d ago

The attacks are aimed at weakening Iran’s ability to threaten commercial shipping in the Strait of Hormuz

Reliability 65 · high3 sources·2 independent voices·2 countries · 1 languages

rewrites detected

us-prasident donald trumpweitverbreitete berichtewall street journalmilliarden dollar

4 d ago

Donald Trump orders return of steam catapults on US aircraft carriers

Reliability 63 · high2 sources·2 independent voices

burger kingdeutschlanddeutschland-chef andreas borkbranchenportals food service

35 d ago

Fast food: Burger King wants to resume expansion

Reliability 63 · high3 sources·2 independent voices

rewrites detected

Dreamz Studio

Need a website or app?

Dreamz Studio designs and builds custom websites, web platforms and mobile apps.

weißen hausesweißen hauswashingtontrump

10 d ago

White House: US court stops construction of Donald Trump ballroom

Reliability 62 · high3 sources·3 independent voices

weißen haustrumpverlustkategorie das us-verteidigungsministeriumisraels ministerprasident benjamin netanjahu

20 d ago

+++ Iran war +++: Meeting between Trump and Netanyahu in the White House ended

Reliability 62 · high3 sources·3 independent voices

us-prasident donald trumpnordkoreas unterstutzungulchi freedom shieldsenator thom tillis

16 h ago

‘He understands me’: Trump makes mysterious hint towards Kim

Reliability 60 · high2 sources·1 independent voice·2 countries · 1 languages

rewrites detected

iran-kriegdie lagechefverhandler mohammed bagher ghalibaflibanons prasidenten joseph aoun

+728 d ago

Despite ongoing ceasefire efforts, both sides continue their attacks as Lebanese army fends off missiles

Reliability 60 · high7 sources·1 independent voice·2 countries · 1 languages

rewrites detected

haushaltsexpertin elke messerschmidtkompetenzzentrum hauswirtschafthaushaltsratgeber le journalwarum weichspuler handtucher

LIVE32 min ago

Towels soft again: This vinegar trick sounds awesome – but has a catch

Reliability 59 · moderate2 sources·1 independent voice

rewrites detected

donald trumps gesundheitszustandstartseite politik blutergusseex-vizeprasident dick cheneygeorge washington university

LIVE3 h ago

Bleedings, Sleepiness, 22 Doctors: White House Attacks Cardiologists After Questions About Trump's Health

Reliability 59 · moderate2 sources·1 independent voice

rewrites detected

Ecole Work

Manage your school online

Ecole Work is the all-in-one platform for schools — schedule, grades, homework and more.

content-partnerschaft dieser artikelnordkoreas machthaber kim jong-unrettungsschwimmers ryder williamscnn-journalistin kristen holmes

LIVE4 h ago

“Be quiet!” Angry Trump overwhelms CNN reporter with tirades

Reliability 59 · moderate2 sources·1 independent voice

rewrites detected

high performance architecturestartseite verbraucher standaußenliegenden sonnenschutzarchitekt christos floros

LIVE5 h ago

Greek method beats any air conditioning – rooms cool down to 20 degrees

Reliability 59 · moderate2 sources·1 independent voice

rewrites detected

bill clintonnew yorker sexualstraftater jeffreyweißen haus bekanntester skandaldas amtsenthebungsverfahren

+58 h ago

Ex-President: Bill Clinton turns 80: "Comeback Kid" and many scandals

Reliability 59 · moderate5 sources·1 independent voice

rewrites detected

content-partnerschaft dieser artikelveranderte meerestemperaturenim bundesstaat new jerseynew jersey state museum

LIVE1 d ago

Boy Finds Huge Megalodon Tooth on Beach

Reliability 59 · moderate2 sources·1 independent voice

rewrites detected

deutschland hunderttausende fahrraderihr lieblingsausflugszieleinfache kabelschlosserstabile fahrradstander

LIVE1 d ago

ADAC Warns: These Five Mistakes When Connecting Your Bike Will Cost You Your Bike

Reliability 59 · moderate2 sources·1 independent voice

rewrites detected

afd-bundestagsabgeordnete malte kaufmanninnertropischen konvergenzzoneeine bombardier globalsolche trainingsfluge

1 d ago

Seychelles: Government planes stranded in holiday paradise

Reliability 59 · moderate4 sources·1 independent voice

rewrites detected

Dreamz Studio

Need a website or app?

Dreamz Studio designs and builds custom websites, web platforms and mobile apps.

bihlmayerfotografie neue ermittlerergebnissezerborstenes fenster das flugzeugbei ryanair-flug fr1879vorlaufige erkenntnisse

LIVE4 d ago

New findings on horror flight: investigators find bird remains in the engine

Reliability 59 · moderate2 sources·1 independent voice

rewrites detected

immobilienunternehmer nicholas ricciosexualstraftater jeffrey epsteinwohlwollende berichterstattungunterstutzerinnen trumps der

4 d ago

White House: Trump needs a new voice: Karoline Leavitt goes

Reliability 59 · moderate2 sources·1 independent voice

rewrites detected

startseite politik jungste pressesprecherinersten stellvertretenden pressesprecherinerster stellvertretender pressesprechertrump-vertrauten vizeprasident jd vance

LIVE5 d ago

Youngest press secretary in history goes: Who follows Karoline Leavitt in the briefing room?

Reliability 59 · moderate2 sources·1 independent voice

rewrites detected

content-partnerschaft dieser artikelrusslands pazifikflotte manoverwachsende spannungen russlandsprasident wolodymyr selenskyj

LIVE5 d ago

Putin warns of NATO in the Pacific – and protects his submarines from drones

Reliability 59 · moderate2 sources·1 independent voice

rewrites detected

kein sprengstoffein technikerstartseite politik deutschland entscharfungrobotik anzeige presseportal direkt

5 d ago

Defusing: No explosives found in Treuchtlingen

Reliability 59 · moderate3 sources·1 independent voice

rewrites detected

fruhstucksgetranken manche fruhstucksgetrankecontent-partnerschaft dieser artikeldiabetes-expertin toby smithsonamerican diabetes association

LIVE5 d ago

Wrong coffee, too little protein: Diabetes expert explains the most common breakfast mistakes

Reliability 59 · moderate2 sources·1 independent voice

rewrites detected

Ecole Work

Manage your school online

Ecole Work is the all-in-one platform for schools — schedule, grades, homework and more.

vorfahrtsregelung die dreieckemedia funke foto servicesimago die markierungfunke foto services

LIVE5 d ago

Shark teeth on the road: What the triangles really mean

Reliability 59 · moderate2 sources·1 independent voice

rewrites detected

trumps prasidentschaftswahlkampfregierungssprecherin leavittus-bundesstaat pennsylvaniawahrend leavitts elternzeit

LIVE5 d ago

Shortly before the midterm elections: Trump spokeswoman Leavitt leaves the White House

Reliability 59 · moderate2 sources·1 independent voice

rewrites detected

trumps sprecherin leavittrepublikanischen parteiuhr kommentare unskaroline leavitt

LIVE5 d ago

Trump’s spokeswoman Leavitt stops – this is behind their decision

Reliability 59 · moderate2 sources·1 independent voice

rewrites detected

wahrend heimatschutzministerin kristi noemarbeitsministerin lori chavez-deremerkommunikationsdirektor steven cheungsexualstraftater jeffrey epstein

LIVE5 d ago

Leavitt steps down as White House spokeswoman – at worst possible time

Reliability 59 · moderate2 sources·1 independent voice

rewrites detected

trumps tauschungrakete grundweiße hausus-prasident donald trump

5 d ago

President in the catering trail: Media: threat by missile reason for Trump’s deception

Reliability 59 · moderate4 sources·1 independent voice

rewrites detected

imago eineinhalb jahreder pyrenaenberghundmischlingshund sorenuhr kommentare uns

LIVE5 d ago

Mimi, the big ball of fluff, no longer wants to be alone: Who gives her a second chance?

Reliability 59 · moderate2 sources·1 independent voice

rewrites detected

sportlicher hahnchen-brokkoli-auflaufhahnchen-brokkoli-auflauf low carbrezept-highlight entdecken sieshotshop unser rezept

6 d ago

Sporty Chicken Broccoli Casserole: Simple, Low Carb and High Protein

Reliability 59 · moderate2 sources·1 independent voice

rewrites detected

rezept-highlight entdecken siemascarpone dieses triflespritzer orangensaftdie mascarponecreme

7 d ago

Trifle with blueberries and mascarpone: a dessert in the glass that leaves an impression

Reliability 59 · moderate2 sources·1 independent voice

rewrites detected

turkeitrumpkommunikationsdirektor steven cheungluftwaffenstutzpunkt mildenhall

+57 d ago

Security of the US President: Report: Trump secretly in the catering car from Jet

Reliability 59 · moderate5 sources·1 independent voice

rewrites detected

katastrophenschutzreferent landeshauptmann daniel fellnerkatastrophenschutzubung wasserregion friaul-julisch venetienin friaul-julisch venetien

7 d ago

Next Italy region affected by forest fires: planes fetch extinguishing water in neighboring country

Reliability 59 · moderate2 sources·1 independent voice

rewrites detected

eine wetter-kolumnekurzfristige musterpeter kneffel warummillionen deutsche

LIVE8 d ago

Ten hot days of August, months of snow? What's Really Behind the Old Peasant Rule

Reliability 59 · moderate2 sources·1 independent voice

rewrites detected

content-partnerschaft dieser artikelchinas open-weight-offensive offenestartseite wirtschaft offene kibusiness punk die us-regierung

LIVE8 d ago

Open AI from China threatens America’s supremacy – this is how the White House reacts

Reliability 59 · moderate2 sources·1 independent voice

rewrites detected

prasident trumps umgestaltung washingtonsdonald trumps prasidentschaftswahlkampfnational capital planning commissionregion greater washington

LIVE8 d ago

Trump Appoints Will Scharf as New Chief Attorney: “I know Will well!”

Reliability 59 · moderate2 sources·1 independent voice

rewrites detected

rezept-highlight entdecken sieklassische gyrosspießegriechenland-feelingzoonar unser rezept

8 d ago

Gyroskeets with Tzatziki: spicy, juicy and irresistible

Reliability 59 · moderate2 sources·1 independent voice

rewrites detected

heilige birma standuhr kommentare unsheilige birmasheiligen birma

LIVE8 d ago

Cat breed with grace, character and charm – the Holy Burma

Reliability 59 · moderate2 sources·1 independent voice

rewrites detected

rezept-highlight entdecken sieschwarzwalder kirschtortedie zubereitungszeitnussboden laden sie

9 d ago

Raspberry mascarpone cake with nut bottom – so elegant baking can be

Reliability 59 · moderate2 sources·1 independent voice

rewrites detected

die prostatakrebserkrankungus-prasidenten joe bidenzur amtszeit obamasder demokrat biden

9 d ago

Son Talks About Disease: Cancer of Ex-US President Biden Has Spread

Reliability 59 · moderate2 sources·2 independent voices

midterms sein nettozustimmungswertpartner-content dieser texttrumps nettozustimmungswertus-prasident donald trump

9 d ago

Before the Midterms: Drastic U-turn among white voters in Trump poll

Reliability 59 · moderate2 sources·1 independent voice

rewrites detected

iran-gespracheneue hypothekus-prasident trumpprasident recep tayyip erdogan

11 d ago

New mortgage for Iran talks: Yemen conflict escalates

Reliability 59 · moderate4 sources·1 independent voice

rewrites detected

iran-kriegim kriegeu-kommissionsprasidentin ursulaelektronische kriegsfuhrung

18 d ago

Iran War: GPS Disruptions: The Invisible Front in the Iran War

Reliability 59 · moderate4 sources·1 independent voice

rewrites detected

ajatollah modschtaba chameneius-prasident donald trumpus-senator lindsey grahamunterstutzer israels

20 d ago

Memorial for Graham: Iran and Ukraine War: Netanyahu and Zelensky with Trump

Reliability 59 · moderate2 sources·1 independent voice

rewrites detected

kanadas ex-premier justin trudeaustefano dalle luche agfus-superstar katy perrykriegsvideo katy perry

21 d ago

'Total Betrayal': Katy Perry 'horrified and angry' about White House

Reliability 59 · moderate2 sources·1 independent voice

rewrites detected